PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022256
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 389aa    MW: 43433.1 Da    PI: 9.7795
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022256genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.6e-14196242148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W + Edell+++v  +G ++W+ I + +g gR +kqc++rw+++l
      Lus10022256 196 KGPWIPKEDELLIQLVGVHGLKRWAVIGNIIG-GRLGKQCRERWHNHL 242
                      79******************************.*************97 PP

2Myb_DNA-binding58.71.3e-18248290145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +W++eEde l++a+k++G++ W+ Ia++++ gRt++++k++w+
      Lus10022256 248 KEAWSKEEDEMLINAHKEMGNR-WAEIAKRLP-GRTENNIKNHWN 290
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.492191242IPR017930Myb domain
SMARTSM007175.7E-13195244IPR001005SANT/Myb domain
SuperFamilySSF466892.7E-29195289IPR009057Homeodomain-like
PfamPF002493.8E-13196242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-23197249IPR009057Homeodomain-like
CDDcd001671.22E-11198242No hitNo description
PROSITE profilePS5129426.235243297IPR017930Myb domain
SMARTSM007176.1E-18247295IPR001005SANT/Myb domain
PfamPF002497.6E-17248290IPR001005SANT/Myb domain
CDDcd001671.68E-14250293No hitNo description
Gene3DG3DSA:1.10.10.604.6E-22250295IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEFGKHNNFT NHKRGVSSAF SSVKKTPANG FLGFSNTANG SSSDSSPIIH NENKPPYIPA  60
FLQQPPPPPP PYSSSWPVDP ILNLQRGFSS YHHHYHYHYY HNIDHLTPTH NINREMNLFP  120
TGHSGNHNHP GGNNLNSLGG ARTAQEQDDK GKKIKNDEKK SGFTIPNHTS RGNEVDKESQ  180
QIRIKAPAPE HQLIIKGPWI PKEDELLIQL VGVHGLKRWA VIGNIIGGRL GKQCRERWHN  240
HLKPHIKKEA WSKEEDEMLI NAHKEMGNRW AEIAKRLPGR TENNIKNHWN ATKRRRFPSI  300
RRNNRSAASS DYGAALKGYI DSLAPSSARR GVNKSTSAKA STSAPAASAT ATSDPEFGVE  360
FANVNSLADD DDSSEDDDDS WVWDSYYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-451352971159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-451352971159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072509.14e-54PREDICTED: transcription factor MYB98
TrEMBLA0A067LDF54e-54A0A067LDF5_JATCU; Uncharacterized protein
TrEMBLA0A067LGF98e-54A0A067LGF9_JATCU; MYB family protein
STRINGGLYMA06G19280.22e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.14e-48myb domain protein 118